PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_020828-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 519aa    MW: 57732.9 Da    PI: 9.1505
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_020828-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.2e-1758104148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEde l +av+ + g++Wk+Ia+ ++  R++ qc +rwqk+l
  AHYPO_020828-RA  58 KGGWTPEEDETLRNAVADFKGKNWKKIAEFFP-DRSEVQCLHRWQKVL 104
                      688*****************************.************986 PP

2Myb_DNA-binding57.72.8e-18110156148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+ Ede+++++v+ +G+  W+ Ia+ ++ gR +kqc++rw+++l
  AHYPO_020828-RA 110 KGPWTQKEDEKILELVEIYGPTKWSVIAKSLP-GRIGKQCRERWHNHL 156
                      79******************************.*************97 PP

3Myb_DNA-binding30.67.9e-10162193134
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkg 34 
                      +++WT eE++ l +a++++G++ W+ Ia+ ++ g
  AHYPO_020828-RA 162 KDAWTLEEELELMNAHHMYGNK-WAEIAKVLP-G 193
                      679*******************.******999.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.36153104IPR017930Myb domain
SMARTSM007171.7E-1557106IPR001005SANT/Myb domain
PfamPF002498.4E-1658104IPR001005SANT/Myb domain
SuperFamilySSF466891.87E-1559114IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-2260112IPR009057Homeodomain-like
CDDcd001671.89E-1361104No hitNo description
PROSITE profilePS5129430.981105160IPR017930Myb domain
SuperFamilySSF466892.71E-25107193IPR009057Homeodomain-like
SMARTSM007171.8E-17109158IPR001005SANT/Myb domain
PfamPF002492.0E-17110156IPR001005SANT/Myb domain
CDDcd001676.54E-15112156No hitNo description
Gene3DG3DSA:1.10.10.603.2E-26113159IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.7E-12160193IPR009057Homeodomain-like
PROSITE profilePS512947.57161215IPR017930Myb domain
SMARTSM007170.0034161213IPR001005SANT/Myb domain
PfamPF002491.1E-8162193IPR001005SANT/Myb domain
CDDcd001672.42E-5164193No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 519 aa     Download sequence    Send to blast
MVEGDMTVEK WCLENKQSAA ASSSSVSEGS ASVTLKSSSP TRSSPTHRRT TGPIRRAKGG  60
WTPEEDETLR NAVADFKGKN WKKIAEFFPD RSEVQCLHRW QKVLNPELVK GPWTQKEDEK  120
ILELVEIYGP TKWSVIAKSL PGRIGKQCRE RWHNHLNPDI KKDAWTLEEE LELMNAHHMY  180
GNKWAEIAKV LPGSYGKLPP VSKTTLQNNV RDAERPTSTG KLVVGSNKES DSSAQTSSSA  240
TDLKRPDDKI SELEMSNKIQ DICASSFRAY ESADPDIINR SSYVNFPCQN SKCLPYDNCG  300
GVDHIEQNEA VTPQWPVNPI NRSLYFKPLH YETSPSESNL ANSHTKPDYG PETAFFTPTG  360
VKSTTRTVGS VRHLESILKI AAKTFSNPPA IIRKRKAQFQ SPQSKNSRID EAFCKDKCSP  420
SSEKQTAIYP SSCQDGGLPS TPPSNTPVVT EHCNGKSYNA SPPYRFRPKR TAIIKSIEKQ  480
LQFSMDKEKK DDAKSLDLQL RGNAPIREGI SSKSMGVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-57571935141MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-57571935141MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678081.10.0PREDICTED: myb-related protein B
RefseqXP_010678082.10.0PREDICTED: myb-related protein B
RefseqXP_010678083.10.0PREDICTED: myb-related protein B
TrEMBLA0A0J8CGC20.0A0A0J8CGC2_BETVU; Uncharacterized protein
STRINGVIT_08s0007g00360.t011e-157(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09370.12e-98myb domain protein 3r-3